[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68484.1
DDBJ      :             putative monooxygenase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  246/915 : Eukaryota  83/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.47.1
:530 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->522 3fmwC PDBj 3e-62 42.1 %
:RPS:PDB   28->365 3c96A PDBj 3e-24 20.1 %
:RPS:SCOP  135->270 1d4cA2  c.3.1.4 * 2e-05 18.4 %
:RPS:SCOP  296->419 1fohA5  c.3.1.2 * 2e-19 28.2 %
:RPS:SCOP  398->527 1fohA3  c.47.1.10 * 2e-09 15.0 %
:HMM:SCOP  1->384 1k0iA1 c.3.1.2 * 1.9e-51 40.3 %
:RPS:PFM   67->363 PF01494 * FAD_binding_3 8e-22 38.8 %
:HMM:PFM   2->373 PF01494 * FAD_binding_3 1.9e-70 34.9 344/356  
:BLT:SWISS 130->524 TCMG_STRGA 9e-33 35.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68484.1 GT:GENE BAC68484.1 GT:PRODUCT putative monooxygenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(923778..925370) GB:FROM 923778 GB:TO 925370 GB:DIRECTION - GB:PRODUCT putative monooxygenase GB:NOTE PF01360: Monooxygenase GB:PROTEIN_ID BAC68484.1 LENGTH 530 SQ:AASEQ MDVTVVGAGPVGLVLAAELALTGATVQVLERRAEPDEAMKAQSINMPTAEALDRRGLLPAAEKVQREMLERVGSFTRMVDDRTPGEGRRAPDSRFTGHFAGMVLDADLVDWSDPDLAAHTAADGARLVPQRELEELLADHVARLGVPVRRGVEVTTLEDTGDGVLVGTAAGAVRTGWLVGCDGGHSAVRRLAGIDFPGTDPELTGHLAVVDIADPEKLANGWAWSTRGAYRYGPQPGRVVTVEFDGPPADLPHARLRSRGGTPVAPVTLEELQTSLRRVSGTDVTLTALRGAATRWTDNARQAATYRSGRVLLAGDAAHVHPPFGGQGLNLGVGDAMNLGWKLGAVVAGWAPEGLLDTYDAERRPLGAWVLDWTRAQIGVLRGDAKSAALREVVGDLLSTRAGTTYAVKKISGVDQRIDLLGDHPLVGRFVPDLWLRDGSRLADHGHDGGFLLLDRTPEGAFARLAAAWDGRVSSVTDDHATPTGVLVRPDGVVAWASDTTGNAAVTGLEATLHRWTGAPSSSPEHEPVG GT:EXON 1|1-530:0| BL:SWS:NREP 1 BL:SWS:REP 130->524|TCMG_STRGA|9e-33|35.8|380/572| SEG 3->26|vtvvgagpvglvlaaelaltgatv| BL:PDB:NREP 1 BL:PDB:REP 28->522|3fmwC|3e-62|42.1|444/489| RP:PDB:NREP 1 RP:PDB:REP 28->365|3c96A|3e-24|20.1|308/381| RP:PFM:NREP 1 RP:PFM:REP 67->363|PF01494|8e-22|38.8|276/338|FAD_binding_3| HM:PFM:NREP 1 HM:PFM:REP 2->373|PF01494|1.9e-70|34.9|344/356|FAD_binding_3| GO:PFM:NREP 2 GO:PFM GO:0004497|"GO:monooxygenase activity"|PF01494|IPR002938| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01494|IPR002938| RP:SCP:NREP 3 RP:SCP:REP 135->270|1d4cA2|2e-05|18.4|136/322|c.3.1.4| RP:SCP:REP 296->419|1fohA5|2e-19|28.2|124/360|c.3.1.2| RP:SCP:REP 398->527|1fohA3|2e-09|15.0|127/201|c.47.1.10| HM:SCP:REP 1->384|1k0iA1|1.9e-51|40.3|243/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 921 OP:NHOMOORG 329 OP:PATTERN -------------------------------------------------------------------- --1191-1222---553----2--66------755543EA-726-1------353113--491-52A7433-----------1------------------------1----------------------------------------1----------------------------------1-1-------111111-12-11112-1-11-1111----111------1---------------------------------------------------------------------------------------------------------------------------------------------1--1---------19961--1-1111111111-11--11311512132-2--4211252112422-232-1---1111111111--1-1----------------------------------28--211133455442222244352222226492831--11112---213-43--1----------------1111---------------------------48-----------------------------11---2------------------------------1-------------111-1---11-11111-11111-111-11-121-112-1----11111--1----------1-------------------1---111111-11------------------1-------------112----1-1-1--------------11111-----11----------------------------------------------------------------------- -1-------------4393E9C8G9GC3322123333323233222425968FB44865666--1----1----1------22211---5U734C3----1-3321--6-------------------------------------------------1------------------1--1111111-2911---1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 495 STR:RPRED 93.4 SQ:SECSTR ###########################EEEccccccccccEEEEcHHHHHHHHHTTcHHHHHHHcEEEcEEccEEEEEEcHHHHTTHHHHTTccEEEEEccEEEEEETTEEEEEcGGGGTccccEEEEEHHHHHHHHHHHHHHHHcTTEEcEEEEEEEEETTEEEEEEEETTEEEcEEEEcccTTcHHHHHHcTTccccEEEEEEEEEEEEEcccTTccEEEEEEcTTccEEEEEEccHHHHTTTcEEEEHHHHccccccccTTccccHHHHHHHHTTcccTTccHHHHHHTccEEEEEcccccccccTTEEEcTHHHHcccccTTcTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHTcccHHHHHHHHTccccccccccHHHHHHHHHHHHHHHHHTcHHHTccccHHHHHHHHHHHTTccccccGGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHTccEEEEEcTTccccHHHHHHHHHHHHccccc######## DISOP:02AL 523-530| PSIPRED cEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccEEccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccEEEccHHHccccHHHHcccccccEEEEEHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEccEEEEEEEEEEcccccHHHHHHcccccccccccEEEEEEEEEcccccccccEEEEccccEEEEEEccccEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEEccccEEEEEccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccEEcccccHHHHHccccEEEEEcccccccHHHcccccccEEEEccccccccEEEEEccEEEEEccccccccHHHHHHHHHHHHHccccccccccccc //