Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68486.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:82 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68486.1 GT:GENE BAC68486.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(926268..926516) GB:FROM 926268 GB:TO 926516 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68486.1 LENGTH 82 SQ:AASEQ MVPVGLLSNTSGGAAMAAVFTLAVHRPFRYVAWIGGVDLALVPLLYWLRSYPTCLTPESSRSPSCSTCRSSAGACSSVPNGC GT:EXON 1|1-82:0| TM:NTM 1 TM:REGION 20->42| SEG 56->71|tpessrspscstcrss| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 60-68| PSIPRED ccccccccccccHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHcccccEEccccccccccHHHHccccccccccccc //