[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68487.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->122 PF07299 * FBP 9e-13 37.7 %
:HMM:PFM   21->118 PF07299 * FBP 1.1e-10 30.0 90/208  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68487.1 GT:GENE BAC68487.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(926586..927077) GB:FROM 926586 GB:TO 927077 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68487.1 LENGTH 163 SQ:AASEQ MKPLTEPEIRTAFVNCTKGEAKRLSVPRDLAERPWDDLDFLGWRDPQAPDRAYLATERDGRPVALALRCPSATSWQTRRSMCSMCMTTHTGGVSLMVAAKAGKAGQQGNSVGAYICSDLACSLYVRGKKDAGVGARLPESLTLDEKIQRTVANLAALIAKVTA GT:EXON 1|1-163:0| SEG 98->108|aakagkagqqg| RP:PFM:NREP 1 RP:PFM:REP 1->122|PF07299|9e-13|37.7|114/207|FBP| HM:PFM:NREP 1 HM:PFM:REP 21->118|PF07299|1.1e-10|30.0|90/208|FBP| OP:NHOMO 25 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----2------1------------------------2-11----111--11-1111-1------2--222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 99-108, 132-135| PSIPRED cccccHHHHHHHHccccccccEEEcccccccccccccccEEEcccccccccEEEEEEccccEEEEEEEcccccccccHHHHHHHHHccccccEEEEEEEcccccccccccEEEEEEHHHHHHHHHccEEcccccccccccccHHHHHHHHHHHHHHHHHHHcc //