[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68492.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 4->33 YM3_STRCO 2e-07 72.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68492.1 GT:GENE BAC68492.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(930904..931179) GB:FROM 930904 GB:TO 931179 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68492.1 LENGTH 91 SQ:AASEQ MVVRHLLNRLLGQLHHCVMTTRQKYDEAIGFAPPVPPQLATTTVAGLDVTGACTRRPGRGRHRTCHREGRRGSRPAVMVRGSVTTGTDMPG GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 4->33|YM3_STRCO|2e-07|72.4|29/100| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 62-70, 87-91| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccccccccccccccccccHHHccccccccEEEEEccccccccccc //