[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68493.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->87 PF09972 * DUF2207 1.3e-05 41.7 48/511  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68493.1 GT:GENE BAC68493.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 931759..932133 GB:FROM 931759 GB:TO 932133 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68493.1 LENGTH 124 SQ:AASEQ MRTFTRKSIVVSHLSAKGMMRRDEAPTSRNRPPSLGPRRAGLLLLLLILLLVLLLLVLLLLILLLLILLLLILLLVLLLVLLLVLLLPCSGRRGPVILRRHTLRRRSLGLDLRGRLRGSRRLGH GT:EXON 1|1-124:0| TM:NTM 2 TM:REGION 40->62| TM:REGION 66->88| SEG 42->87|llllllilllvllllvllllillllillllilllvlllvlllvlll| SEG 103->123|lrrrslgldlrgrlrgsrrlg| HM:PFM:NREP 1 HM:PFM:REP 30->87|PF09972|1.3e-05|41.7|48/511|DUF2207| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 18-36, 118-124| PSIPRED cccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHcccccccc //