Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68494.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:182 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68494.1 GT:GENE BAC68494.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 932225..932773 GB:FROM 932225 GB:TO 932773 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68494.1 LENGTH 182 SQ:AASEQ MPSDGVDSLPDSDDPDSDSLSDSLSGFDSLSGFDEDGLPGSDGFDDFDSLSGFDDLSGFDDSDSGDFDSLSDFDDSDSDFPPDSDGFDDFDSLSGFDDLSGFDDSDSGGFDSLPGSDDCDSLPDSGGRCTGGAVFLSCVPRSSPCSRVNQSPFSGPATTNFFTAWGAGATTTAPEGRYPGHA GT:EXON 1|1-182:0| SEG 2->34|psdgvdslpdsddpdsdslsdslsgfdslsgfd| SEG 36->118|dglpgsdgfddfdslsgfddlsgfddsdsgdfdslsdfddsdsdfppdsdgfddfdslsgfddlsgfddsdsggfdslpgsdd| SEG 157->173|attnfftawgagattta| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19, 176-182| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHcccccccccccccEEEccccccccccccccccccc //