[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68495.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:161 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->158 2qntA PDBj 8e-04 27.4 %
:RPS:PDB   38->156 2ei1A PDBj 2e-11 19.2 %
:RPS:SCOP  38->156 2pjsA1  d.32.1.2 * 2e-11 20.8 %
:HMM:SCOP  35->159 1q0oA2 d.32.1.3 * 3.2e-18 35.9 %
:HMM:PFM   38->115 PF00903 * Glyoxalase 4.3e-07 21.8 78/128  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68495.1 GT:GENE BAC68495.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(934229..934714) GB:FROM 934229 GB:TO 934714 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68495.1 LENGTH 161 SQ:AASEQ MAACGCCHCLRGCCSRHSGAMNADDRSLLAGARVATRLPAQDLERARRFYREQLGLEPVDERPGGLLYRCSGADFVVFQSTGSSPGTFTQMAWEVDDIEAVMTELRRRGVVFEEVDVPGFRTRGQVAEIEGNYPSKGARGERGAWFCDSEGNMLGIGEPVL GT:EXON 1|1-161:0| SEG 2->18|aacgcchclrgccsrhs| BL:PDB:NREP 1 BL:PDB:REP 41->158|2qntA|8e-04|27.4|106/124| RP:PDB:NREP 1 RP:PDB:REP 38->156|2ei1A|2e-11|19.2|104/293| HM:PFM:NREP 1 HM:PFM:REP 38->115|PF00903|4.3e-07|21.8|78/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 38->156|2pjsA1|2e-11|20.8|101/111|d.32.1.2| HM:SCP:REP 35->159|1q0oA2|3.2e-18|35.9|103/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- 11-----------------------------------11-------------112-----1-1----1---------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----------------------------1---------------------------------------------------------------------------------------------------------------1----1-1------1-1--1----------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 77.6 SQ:SECSTR ###################################EEEEEccHHHHHHHHHHTTccEEEccccccEEEEEccccEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHTTcccEEccHHHHHHHTEEEcccccEEcccTTEEEEEEEEcTTccEEEEEEcc# DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHccccccHHHHHHHcccEEEEccHHHHHHHHHHHHHHccccEEcccccEEEEEccccEEEEEEccccccccccEEEEEEccHHHHHHHHHHcccEEcccccccccccccccccccccccccccccEEEEEEccccccHHHccccc //