[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68503.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->115 PF07681 * DoxX 2.7e-20 43.9 82/85  
:BLT:SWISS 48->85 MHQP_BACSU 2e-06 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68503.1 GT:GENE BAC68503.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 946221..946775 GB:FROM 946221 GB:TO 946775 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:NOTE PF07681: DoxX GB:PROTEIN_ID BAC68503.1 LENGTH 184 SQ:AASEQ MRVTAQRLRATSGPRDTATTPTSFSAADAGILLLRLAVGLLLAGHGAQKLFGIFGGPGLSATGKGFADMGYRPGDFFAGLAGASEFLGGLGLAVGLLTPLAAAAVVGVMINAMATTAPKGLWAEKGGLEYPLCLAVAAIAIAAVGPGLLSLDRPFRWRHGGWGPAAVALFLGGIGAAIVLALKA GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 48->85|MHQP_BACSU|2e-06|50.0|38/100| TM:NTM 5 TM:REGION 31->53| TM:REGION 73->95| TM:REGION 99->120| TM:REGION 130->152| TM:REGION 164->184| SEG 29->47|agilllrlavglllaghga| SEG 87->108|lgglglavglltplaaaavvgv| SEG 135->144|avaaiaiaav| HM:PFM:NREP 1 HM:PFM:REP 30->115|PF07681|2.7e-20|43.9|82/85|DoxX| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ---------------------------------111------11-----------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-12| PSIPRED cccHHHHHHHccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcc //