[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68506.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:205 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68506.1 GT:GENE BAC68506.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(949418..950035) GB:FROM 949418 GB:TO 950035 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68506.1 LENGTH 205 SQ:AASEQ MAEMRAFRDAVSGWATGGPEGPASDLAVRLGVRTAVLLEGLSDLAAVEALAARRGRDLAAEGVCVVPMGGAMSVGRYAGLLGPPGLGLRLTGLCDEGEQRFYDRGLKRARAPRRGFFVCVTDLEDELIRALGTARVEEILRAEGDFRSWQTFMRQPAHHGRPRQQQLRRFLGTKRGRKIRYGRLLVEALDPEQVPAPLDDLLASL GT:EXON 1|1-205:0| SEG 48->62|ealaarrgrdlaaeg| SEG 75->93|gryagllgppglglrltgl| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------1-1----1----1---------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 155-164| PSIPRED ccHHHHHHHHHHHHHcccccccHHHHHHHHHccEEEEEccHHHHHHHHHHHHHccccHHHccEEEEEEcccccHHHHHHHHcccccccEEEEEEccccHHHHHccccccccccccEEEEEccHHHHHHHHccHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHcc //