Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68507.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:HMM:PFM   55->119 PF07398 * MDMPI_C 3.8e-06 37.0 54/82  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68507.1 GT:GENE BAC68507.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(950601..950984) GB:FROM 950601 GB:TO 950984 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68507.1 LENGTH 127 SQ:AASEQ MAGLPFELDTEVALHLVDAFLSACGDPDARKFLSPLFSEVPRGGQTLCFRSAEEPAGGFSSWLITCAPDGVQVTRNLPTTSVADATVVAAPSDLLLVVKGRLRPEKPRMTVLGSRPLLDLWLSHAIA GT:EXON 1|1-127:0| SEG 78->93|pttsvadatvvaapsd| HM:PFM:NREP 1 HM:PFM:REP 55->119|PF07398|3.8e-06|37.0|54/82|MDMPI_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEccccccccccEEEEEccccEEEEccccccHHHHHHccccHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHcc //