[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68508.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->165 1pw4A_ f.38.1.1 * 1.7e-09 29.2 %
:HMM:PFM   30->161 PF07690 * MFS_1 3.3e-08 28.5 130/353  
:BLT:SWISS 1->66 SOTB_PSEA7 3e-07 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68508.1 GT:GENE BAC68508.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(950995..951585) GB:FROM 950995 GB:TO 951585 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68508.1 LENGTH 196 SQ:AASEQ MAGLGLIPVILQALFLPRLPVTKAVTLRSLGVLLKSGRARVALVMTLLTITAQFAAYTFVAPFLQQQTGAGPTLISTLLLVFAAAGILGNFAAASALTKALRPTVPAVLALLAVSQLLMPLFGTWTVGAFLVLALWGLAYGAVPVALQTWLFHAGGPAGRGARGGGPRRAGLGAARKAEQGVLVALGALRGGRTPG GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 1->66|SOTB_PSEA7|3e-07|33.3|66/396| TM:NTM 6 TM:REGION 8->30| TM:REGION 41->63| TM:REGION 73->95| TM:REGION 99->121| TM:REGION 127->149| TM:REGION 170->190| SEG 82->96|faaagilgnfaaasa| SEG 100->121|alrptvpavlallavsqllmpl| SEG 154->176|aggpagrgargggprraglgaar| SEG 181->193|gvlvalgalrggr| HM:PFM:NREP 1 HM:PFM:REP 30->161|PF07690|3.3e-08|28.5|130/353|MFS_1| HM:SCP:REP 1->165|1pw4A_|1.7e-09|29.2|161/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------111111---------------1111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 18-30, 194-196| PSIPRED cHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //