[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68509.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  23->76 1pw4A_ f.38.1.1 * 8.9e-06 31.5 %
:HMM:PFM   25->76 PF07690 * MFS_1 2.4e-08 25.0 52/353  
:BLT:SWISS 45->75 NEPI_SALPK 8e-05 48.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68509.1 GT:GENE BAC68509.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(951567..951881) GB:FROM 951567 GB:TO 951881 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68509.1 LENGTH 104 SQ:AASEQ MRTAVEAGLGEQLALPVEDAEQPLAPDYSAMLGARALLGIGIGGFWAIAVGVGTRLVPEQLAPRATALIFGGISIGHRRGRTRGPAPGPPVRLARPSSSWPGSA GT:EXON 1|1-104:0| BL:SWS:NREP 1 BL:SWS:REP 45->75|NEPI_SALPK|8e-05|48.4|31/397| SEG 32->44|lgarallgigigg| SEG 76->90|ghrrgrtrgpapgpp| HM:PFM:NREP 1 HM:PFM:REP 25->76|PF07690|2.4e-08|25.0|52/353|MFS_1| HM:SCP:REP 23->76|1pw4A_|8.9e-06|31.5|54/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 98-104| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccc //