[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68510.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->84 2gfnA2 a.121.1.1 * 0.00021 25.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68510.1 GT:GENE BAC68510.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 951882..952160 GB:FROM 951882 GB:TO 952160 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68510.1 LENGTH 92 SQ:AASEQ MTASAEVRPGSPVEGAADRYRLWVRTMFTDLAREAGVADAEGLARQLHLLYDGAGISARMDRDPSAATTARAAAAALFDAAVKDKELVDAGQ GT:EXON 1|1-92:0| SEG 66->81|aattaraaaaalfdaa| HM:SCP:REP 1->84|2gfnA2|0.00021|25.0|84/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 90-92| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHcccHHccccc //