[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68512.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.29.1
:284 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->284 2z42A PDBj 3e-31 41.2 %
:RPS:SCOP  92->283 1vavA  b.29.1.18 * 2e-27 33.7 %
:HMM:SCOP  66->284 1vavA_ b.29.1.18 * 4.1e-61 45.5 %
:RPS:PFM   99->282 PF08787 * Alginate_lyase2 2e-30 48.9 %
:HMM:PFM   66->283 PF08787 * Alginate_lyase2 3.1e-62 42.3 213/236  
:BLT:SWISS 61->283 ALYA_KLEPN 2e-15 34.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68512.1 GT:GENE BAC68512.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 954464..955318 GB:FROM 954464 GB:TO 955318 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68512.1 LENGTH 284 SQ:AASEQ MRMRTLLTSLATATAVTGGLALAAPAAPASPVPTAAGVANTPSGQGSTNVVASPMADPSVAPGGNFDLSVWQLQEPVGSPGSPTTIPSSRLQGANGFQDAYFYTDTRDGAMTFWAPEKGVTTPNSNYARSELREMNRNGTAANWSLSGTHQMKATLRVVSVTSNVCVGQIHLGTGGSSTKPLLELYYRSSGDIVLGTENSPSGGQTLHTVGHVSVGKTWNYTIGVSGGHTIDLTVNGSTTHYAIPSSFDAYKQYFKAGSYNQSSSDSTTKGARVAFYGLTVSHS GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 61->283|ALYA_KLEPN|2e-15|34.1|223/100| SEG 5->39|tlltslatatavtgglalaapaapaspvptaagva| SEG 76->89|pvgspgspttipss| BL:PDB:NREP 1 BL:PDB:REP 58->284|2z42A|3e-31|41.2|216/233| RP:PFM:NREP 1 RP:PFM:REP 99->282|PF08787|2e-30|48.9|182/231|Alginate_lyase2| HM:PFM:NREP 1 HM:PFM:REP 66->283|PF08787|3.1e-62|42.3|213/236|Alginate_lyase2| RP:SCP:NREP 1 RP:SCP:REP 92->283|1vavA|2e-27|33.7|190/222|b.29.1.18| HM:SCP:REP 66->284|1vavA_|4.1e-61|45.5|213/222|b.29.1.18|1/1|Concanavalin A-like lectins/glucanases| OP:NHOMO 46 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ----2--------------------------------------------------------------1-----------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1--4-------------------------------------------------------------------------------------------------------------------------------------------------------------------3-2222-11-5-----222------------------------------------------------------------------------------------------------- ---------------------1-1-1--------------------1123--1-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 77.1 SQ:SECSTR #########################################################ccccHHHHcccTTEEEE########cccTTccEEcHHHTcccTTEEEcTTTccEEEEEETTccccTTccccEEEEEEccTTcTTcccccccEEEEEEEEEEEEccTTEEEEEEEEcTTccEEEEEEEEEEETEEEEEEEEccTTccccEEccEEEEcTTccEEEEEEEETTcEEEEEETTEEEEEEHcGGGGGcEEEEEEEEEEcccccTTccEEEEEEEEEEEEEE DISOP:02AL 1-3, 283-284| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHcccccccccccEEccEEEEEEEEccccccEEEEcHHHcccccccccccEEcccccEEEEEcccccccccccccccEEEEEEccccccccEEEEcccEEEEEEEEEEccccEEEEEEEEccccccccccEEEEEEEccEEEEEEEEccccccEEEEEEcEEcccEEEEEEEEEcccEEEEEEEccccEEEccccccccccEEEEEEEcccccccccccEEEEEEEEEEEEc //