Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68515.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:42 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68515.1 GT:GENE BAC68515.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(958134..958262) GB:FROM 958134 GB:TO 958262 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00098: Zinc knuckle GB:PROTEIN_ID BAC68515.1 LENGTH 42 SQ:AASEQ MRPKREARPPAPRQGARPGAQVPGCPRCPGHGSRKCRNCNAK GT:EXON 1|1-42:0| SEG 2->21|rpkrearppaprqgarpgaq| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-21, 40-42| PSIPRED cccccccccccccccccccccccccccccccccccccccccc //