Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68517.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:HMM:PFM   14->65 PF01381 * HTH_3 0.00018 29.2 48/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68517.1 GT:GENE BAC68517.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 960571..960810 GB:FROM 960571 GB:TO 960810 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01381: Helix-turn-helix GB:PROTEIN_ID BAC68517.1 LENGTH 79 SQ:AASEQ MADLSQLLQQGMRRRHLTAQALAERTGIRTPRIRVFAQDGARGPVHPTEAELAELAAALALPLPEVLDAARTPAEASQV GT:EXON 1|1-79:0| SEG 49->70|eaelaelaaalalplpevldaa| HM:PFM:NREP 1 HM:PFM:REP 14->65|PF01381|0.00018|29.2|48/55|HTH_3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 74-79| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHcccHHHHHHHccccccccc //