[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68521.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->113 3bl4B PDBj 3e-12 12.5 %
:RPS:SCOP  34->96 2f1lA1  b.41.1.4 * 1e-07 25.4 %
:HMM:SCOP  14->133 1eysH1 b.41.1.1 * 3.6e-20 41.4 %
:HMM:PFM   34->101 PF05239 * PRC 1.6e-05 28.8 66/79  
:BLT:SWISS 24->112 Y1314_DEIRA 6e-05 40.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68521.1 GT:GENE BAC68521.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(964283..964678) GB:FROM 964283 GB:TO 964678 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF05239: PRC-barrel domain GB:PROTEIN_ID BAC68521.1 LENGTH 131 SQ:AASEQ MGAVRSSRRAKEGNSVVSEEIWGYHPASGYQTGTDLIGFKVEATDGSIGKIDKHSDDVGAAHLVVDTGAWIFGKHVLLPAGTITRIDTAERKVYVDRTKDEIKDAPEFDRDKHTGDPGYLEQFGKYYGQHM GT:EXON 1|1-131:0| BL:SWS:NREP 1 BL:SWS:REP 24->112|Y1314_DEIRA|6e-05|40.3|77/100| RP:PDB:NREP 1 RP:PDB:REP 32->113|3bl4B|3e-12|12.5|80/109| HM:PFM:NREP 1 HM:PFM:REP 34->101|PF05239|1.6e-05|28.8|66/79|PRC| RP:SCP:NREP 1 RP:SCP:REP 34->96|2f1lA1|1e-07|25.4|63/75|b.41.1.4| HM:SCP:REP 14->133|1eysH1|3.6e-20|41.4|116/201|b.41.1.1|1/1|PRC-barrel domain| OP:NHOMO 10 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11--2--4-2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 62.6 SQ:SECSTR ###############################EEEccccccccHHHHHHHHHHHHTTccccEcccHHHHcGHHHHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTccccEE################## DISOP:02AL 1-14, 129-131| PSIPRED cccccccHHccccccccccccccccccccccccccEEEEEEEcccccccEEEEccccccEEEEEEEccccccccEEEEccHHHccccccccEEEEcccHHHHHcccccccccccccHHHHHHHHHHccccc //