[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68523.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:118 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->98 3bl4B PDBj 5e-09 4.2 %
:RPS:SCOP  7->70 1pm3A  b.41.1.2 * 2e-04 23.3 %
:HMM:SCOP  1->117 1dxrH1 b.41.1.1 * 3.9e-15 23.5 %
:HMM:PFM   7->68 PF05239 * PRC 1.2e-08 16.1 62/79  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68523.1 GT:GENE BAC68523.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(965305..965661) GB:FROM 965305 GB:TO 965661 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF05239: PRC-barrel domain GB:PROTEIN_ID BAC68523.1 LENGTH 118 SQ:AASEQ MIHAADVREWRNRDVVDTEGHKIGVLEAVYVDTTTDEPAMATVRTGLPTRHRLTFVPLEDAIAGPGYLKVGYVRALVKQAPSIGTDDVLPADQEEAIFKHYGLPYEPGAAGERQLARR GT:EXON 1|1-118:0| RP:PDB:NREP 1 RP:PDB:REP 3->98|3bl4B|5e-09|4.2|96/109| HM:PFM:NREP 1 HM:PFM:REP 7->68|PF05239|1.2e-08|16.1|62/79|PRC| RP:SCP:NREP 1 RP:SCP:REP 7->70|1pm3A|2e-04|23.3|60/69|b.41.1.2| HM:SCP:REP 1->117|1dxrH1|3.9e-15|23.5|115/222|b.41.1.1|1/1|PRC-barrel domain| OP:NHOMO 19 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----2---------------------------------------1--2----11--1------1-113221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 89.0 SQ:SECSTR ##ccEEEEccccccccHHHHHHHHHHHHHHTTccccEEEcccHHHHHHHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTccccEEEEccHHHHHHHHTTccccc########### DISOP:02AL 1-3, 78-89, 113-118| PSIPRED cccccccHHHcccEEEcccccccccEEEEEEEccccEEEEEEEEcccccccEEEccccccccccccEEEEcccHHHHHccccccccccccHHHHHHHHHHccccccccccccHHHccc //