[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68524.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68524.1 GT:GENE BAC68524.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(966143..966421) GB:FROM 966143 GB:TO 966421 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68524.1 LENGTH 92 SQ:AASEQ MFVLLLILIVVLFGLGFLSPLWWVAAAVLVFGATRYGRGGGGGWISGDGSDLGEYRDYENRRDRQDRWDRRYSRQHRARWTREDRRDRERRG GT:EXON 1|1-92:0| TM:NTM 1 TM:REGION 8->30| SEG 2->18|fvlllilivvlfglgfl| SEG 32->53|gatrygrgggggwisgdgsdlg| SEG 61->74|rrdrqdrwdrrysr| SEG 82->91|redrrdrerr| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 64-66, 77-92| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccc //