[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68525.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:59 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68525.1 GT:GENE BAC68525.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 967134..967313 GB:FROM 967134 GB:TO 967313 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68525.1 LENGTH 59 SQ:AASEQ MVWILLLLLILVVFGFGFTMQALWWVAAVLLVVWIVGVAMRGRGGGGRGVGRRYGHSRR GT:EXON 1|1-59:0| TM:NTM 1 TM:REGION 11->33| SEG 4->17|illlllilvvfgfg| SEG 22->39|alwwvaavllvvwivgva| SEG 41->58|rgrggggrgvgrryghsr| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 50-59| PSIPRED cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccccc //