[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68526.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.60.11
:57 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->57 1rykA  a.60.11.1 * 2e-05 26.9 %
:HMM:SCOP  2->58 1rykA_ a.60.11.1 * 0.00044 26.3 %
:HMM:PFM   6->57 PF05532 * CsbD 1.1e-15 36.5 52/53  
:BLT:SWISS 1->56 Y1672_COREF 8e-09 37.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68526.1 GT:GENE BAC68526.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 967424..967597 GB:FROM 967424 GB:TO 967597 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF05532: CsbD-like GB:PROTEIN_ID BAC68526.1 LENGTH 57 SQ:AASEQ MSVGQTIKHKTQAFKGRVTERIGRTTRNRRLQREGRTDQISGNLKQSGDKAKDAFKR GT:EXON 1|1-57:0| BL:SWS:NREP 1 BL:SWS:REP 1->56|Y1672_COREF|8e-09|37.5|56/58| HM:PFM:NREP 1 HM:PFM:REP 6->57|PF05532|1.1e-15|36.5|52/53|CsbD| RP:SCP:NREP 1 RP:SCP:REP 6->57|1rykA|2e-05|26.9|52/69|a.60.11.1| HM:SCP:REP 2->58|1rykA_|0.00044|26.3|57/69|a.60.11.1|1/1|Hypothetical protein YjbJ| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------1-----------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15, 27-53| PSIPRED ccccHHHHHHHHHHccHHHHHHcccHHHHHHHHHccHHHHHHHHHHccHHHHHHHcc //