[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68527.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:HMM:PFM   1->58 PF03992 * ABM 3.4e-06 20.7 58/78  
:HMM:PFM   42->81 PF11984 * DUF3485 0.00054 29.7 37/206  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68527.1 GT:GENE BAC68527.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(968219..968503) GB:FROM 968219 GB:TO 968503 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03992: Antibiotic biosynthesis monooxygenase GB:PROTEIN_ID BAC68527.1 LENGTH 94 SQ:AASEQ MYAAVRRYEGVTDPAEAARLVNEGFVGLMREVPGFVAYYWVDAGNGVMVSTSVFQDRAGAEESISRASDFVRDNLASLLPNPPQVMAGAVVASA GT:EXON 1|1-94:0| HM:PFM:NREP 2 HM:PFM:REP 1->58|PF03992|3.4e-06|20.7|58/78|ABM| HM:PFM:REP 42->81|PF11984|0.00054|29.7|37/206|DUF3485| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccccHHHEEEEEEEcc //