[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68533.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 58->146 Y3692_BRUSI 9e-04 34.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68533.1 GT:GENE BAC68533.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(974221..974766) GB:FROM 974221 GB:TO 974766 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68533.1 LENGTH 181 SQ:AASEQ MTNWIQGPFPGHEVNVVFARGIPLDTLTRGLRDRLREPLVYGEANGWAWAVHDMHNWDAEDYDDVDYSGMCPEGAEIVVFVTEPCSAKAFPPAFEYHRDGRAILCFSFEDIQQRVGENPDYLSAELLAANLIGPTAECGQQGDDGHDCFDHHYDDHERLVTVIADCFALPAPPLSAEVTAK GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 58->146|Y3692_BRUSI|9e-04|34.1|85/248| SEG 24->36|ldtltrglrdrlr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 179-181| PSIPRED ccccccccccccEEEEEEEccccHHHHHHHHHHHHHccEEEEccccEEEEEccccccccccccccccccccccccEEEEEEEccccccccccHHHHcccccEEEEEEHHHHHHHHcccccHHHHHHHHHHHccccHHHcccccccccHHHcccccHHHHHHHHHHHHHccccccccEEccc //