[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68539.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:HMM:PFM   17->39 PF12616 * DUF3775 0.00065 21.7 23/75  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68539.1 GT:GENE BAC68539.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(983146..983523) GB:FROM 983146 GB:TO 983523 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68539.1 LENGTH 125 SQ:AASEQ MHFYVDVSWLLDVQEAALGREDMSVSDYSALVAAIARHKTKLPTLAAADPDAAWRAAALMHTIVRLEPLPHRNSLFAAFIAAQYMDQSGEGIDPPYGALSDLVSKIRDTRLGILAVADQLRTWKV GT:EXON 1|1-125:0| SEG 46->58|aaadpdaawraaa| HM:PFM:NREP 1 HM:PFM:REP 17->39|PF12616|0.00065|21.7|23/75|DUF3775| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEHHHHHHHHHHHccccccEEEcHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccc //