[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68540.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->26 PF09386 * ParD 0.00073 41.7 24/79  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68540.1 GT:GENE BAC68540.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(983523..983747) GB:FROM 983523 GB:TO 983747 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68540.1 LENGTH 74 SQ:AASEQ MSFTDEELEGVRAAAAAEGKSLKQYLHDLGVREMQRKQFVAGATAWADRLRREFDDAFADEVPPSERRDGAAAA GT:EXON 1|1-74:0| HM:PFM:NREP 1 HM:PFM:REP 3->26|PF09386|0.00073|41.7|24/79|ParD| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 5-6, 65-74| PSIPRED ccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //