[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68561.1
DDBJ      :             putative MbtH-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  173/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.100.2
:72 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->67 2khrA PDBj 1e-21 56.1 %
:RPS:SCOP  9->68 2pstX1  d.100.2.1 * 9e-16 40.0 %
:RPS:PFM   1->53 PF03621 * MbtH 3e-16 62.3 %
:HMM:PFM   1->53 PF03621 * MbtH 2e-29 56.6 53/54  
:BLT:SWISS 2->67 MBTH_MYCTU 1e-21 56.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68561.1 GT:GENE BAC68561.1 GT:PRODUCT putative MbtH-like protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1013750..1013968) GB:FROM 1013750 GB:TO 1013968 GB:DIRECTION - GB:PRODUCT putative MbtH-like protein GB:NOTE nrps7 gene cluster, PF03621: MbtH-like protein GB:PROTEIN_ID BAC68561.1 LENGTH 72 SQ:AASEQ MSNPFDDTDGTYLVLCNEEGQHSLWPADLDVPKGWSTVHGPAGHASCVEYVEEQWVDMRPRSLAAAMDQPAR GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 2->67|MBTH_MYCTU|1e-21|56.1|66/71| BL:PDB:NREP 1 BL:PDB:REP 2->67|2khrA|1e-21|56.1|66/74| RP:PFM:NREP 1 RP:PFM:REP 1->53|PF03621|3e-16|62.3|53/53|MbtH| HM:PFM:NREP 1 HM:PFM:REP 1->53|PF03621|2e-29|56.6|53/54|MbtH| RP:SCP:NREP 1 RP:SCP:REP 9->68|2pstX1|9e-16|40.0|60/61|d.100.2.1| OP:NHOMO 216 OP:NHOMOORG 173 OP:PATTERN -------------------------------------------------------------------- ----1------1-134311-11--5311111311112111-212---------11-----23--7232261-------------------------------------------------------------------------2--1--11-----------------1-----------------------1111111111111111--11-1111----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------1---------------------------------------------------------------------1111111111111111111--1111-1-----2--2--1---1--------1----------1-------------------------------11------------------------------------------------------------------------1-11---1-11111-11-1121111111111111111111-----1111111-11-1111-1111--11-----------------------------1---------------------------111111112111111-211------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 98.6 SQ:SECSTR cccccccccccEEEEEETTcccEEEETTccccccEEEEEccccHHHHHHHHHHHHHcccccccccccHccc# DISOP:02AL 66-72| PSIPRED cccccccccccEEEEEcccccEEEcccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHcc //