[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68568.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->73 1i1kA PDBj 1e-07 39.7 %
:RPS:PDB   14->73 1a3gA PDBj 9e-12 38.3 %
:RPS:SCOP  14->73 1a3gA  e.17.1.1 * 1e-11 38.3 %
:HMM:SCOP  1->73 1a3gA_ e.17.1.1 * 1.1e-11 38.4 %
:HMM:PFM   3->53 PF01063 * Aminotran_4 5.5e-09 31.4 51/232  
:BLT:SWISS 16->69 ILVE_PSEAE 3e-07 42.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68568.1 GT:GENE BAC68568.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1024676..1024900 GB:FROM 1024676 GB:TO 1024900 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE nrps7 gene cluster GB:PROTEIN_ID BAC68568.1 LENGTH 74 SQ:AASEQ MPVAEVPVPEADPHQAREVFLTGTASELVPAREIDGHRFEPCGPVFGRLARAFHDTVRGRAFGDLGWSTGVSEQ GT:EXON 1|1-74:0| BL:SWS:NREP 1 BL:SWS:REP 16->69|ILVE_PSEAE|3e-07|42.6|54/307| SEG 2->11|pvaevpvpea| BL:PDB:NREP 1 BL:PDB:REP 16->73|1i1kA|1e-07|39.7|58/298| RP:PDB:NREP 1 RP:PDB:REP 14->73|1a3gA|9e-12|38.3|60/295| HM:PFM:NREP 1 HM:PFM:REP 3->53|PF01063|5.5e-09|31.4|51/232|Aminotran_4| RP:SCP:NREP 1 RP:SCP:REP 14->73|1a3gA|1e-11|38.3|60/295|e.17.1.1| HM:SCP:REP 1->73|1a3gA_|1.1e-11|38.4|73/305|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 83.8 SQ:SECSTR ###########HHHHccEEEEEETTTEEEEccEETTEEcTcccHHHHHHHHHHHHHHHTccccccccEEEccc# DISOP:02AL 74-75| PSIPRED cEEEEEEEcHHHHHHccEEEEEccccEEEEEEEEccEEEccccHHHHHHHHHHHHHHccccccccccEEEcccc //