[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68571.1
DDBJ      :             putative reductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  77/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:297 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->223 3fbsB PDBj 3e-11 33.0 %
:RPS:PDB   51->279 2a87A PDBj 3e-17 21.4 %
:RPS:SCOP  139->287 1fl2A1  c.3.1.5 * 1e-09 16.1 %
:HMM:SCOP  1->286 1f8rA1 c.3.1.2 * 3.1e-25 26.6 %
:HMM:PFM   2->260 PF07992 * Pyr_redox_2 3e-17 25.1 187/202  
:BLT:SWISS 36->279 TRXB_STRCL 7e-09 28.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68571.1 GT:GENE BAC68571.1 GT:PRODUCT putative reductase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1028236..1029129 GB:FROM 1028236 GB:TO 1029129 GB:DIRECTION + GB:PRODUCT putative reductase GB:NOTE nrps7 gene cluster, PF00070: Pyridine nucleotide-disulphide oxidoreductase GB:PROTEIN_ID BAC68571.1 LENGTH 297 SQ:AASEQ MIGAGAAGLTAATMLGRSMRSTLVISQPRRRNSPASSVNNVPYADGAAPADIYRKMEQDAGRYGVTLLWDEVTSVRAYEDHVVVEGGANPGLRCRRLLLATGRVDVLPAWLPDGVWGRSAFDCPYCHTYERSGSTFVCVGTGDETLKLAALSRQFAKRMTVLVGDPSASRGRLAGLLSRHDVEVLCDEVVRASADPAGGVILETAHGRTLSADTLLLGDVARPYRKFAEDLDLELSADGFPETSLYGMTSNPLVYSAGNVEGSPYFMWTGAASSGINAARAICEDLAFASELLDDWE GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 36->279|TRXB_STRCL|7e-09|28.0|232/322| SEG 3->16|gagaagltaatmlg| BL:PDB:NREP 1 BL:PDB:REP 17->223|3fbsB|3e-11|33.0|203/295| RP:PDB:NREP 1 RP:PDB:REP 51->279|2a87A|3e-17|21.4|229/313| HM:PFM:NREP 1 HM:PFM:REP 2->260|PF07992|3e-17|25.1|187/202|Pyr_redox_2| RP:SCP:NREP 1 RP:SCP:REP 139->287|1fl2A1|1e-09|16.1|149/184|c.3.1.5| HM:SCP:REP 1->286|1f8rA1|3.1e-25|26.6|278/371|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 103 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------------------------- ----11-11111--1------1--11------22221111----11---11-1-1-----42--1-1231-------------------------------1---111-1----------------------------------1--------------------------------------111------------------------1111-----------------1--------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------22-2211-1---2---1-1-1111------11---------------------------------------------------------------1--12--------------------1---------1----------------------------------------------------------11------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------1------1------1---------------------------------------------11---------------------------------------------------1- --------------1-------1--11------1--------------------1-----------1----------------------------------------1-1----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 280 STR:RPRED 94.3 SQ:SECSTR ################HTTccEEEEEccccTTTTcccHHHHTTTTcccHHHHHHHHHHHHHHTTcEEEcccEEEEEcccccEEEEETTccEEEEEEEEEcccEEcccccTHHHHTcTTTEEccHHHHGGGGTTcEEEEEcccHHHHHHHHHHTTTccEEEEEcccccccTTHHHHHHHcTTEEEEccEEEEEcccEEEEEEETTcccEEEccccEEEcccEEEccTTTcTTccccTTccccccTTccccccTTEEEcGGGTccccccHHHHHHHHHHHHHHHHHHHHcHHHHHcTc# DISOP:02AL 297-298| PSIPRED cccccHHHHHHHHHHHHccccEEEEEccccccEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEccccEEEEEEccccEEEEEEEEEccccccccccccccccccccEEHHHHHccHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHcccEEEEccEEEEEEccccEEEEEEccEEEEEEcEEEEEccEEcccHHHHHcccEEcccccEEEccccccccccEEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccccc //