[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68574.1
DDBJ      :             putative peptide carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  95/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.28.1
:82 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   19->76 2vsqA PDBj 5e-09 41.4 %
:RPS:PDB   16->82 3ci0K PDBj 2e-11 1.5 %
:RPS:SCOP  11->78 1dnyA  a.28.1.2 * 7e-15 29.4 %
:HMM:SCOP  5->80 1dnyA_ a.28.1.2 * 2.3e-12 32.9 %
:RPS:PFM   14->78 PF00550 * PP-binding 3e-06 35.4 %
:HMM:PFM   15->78 PF00550 * PP-binding 9.6e-18 32.8 64/67  
:BLT:SWISS 12->82 BACB_BACLI 5e-12 42.3 %
:PROS 37->52|PS00012|PHOSPHOPANTETHEINE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68574.1 GT:GENE BAC68574.1 GT:PRODUCT putative peptide carrier protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1032421..1032669) GB:FROM 1032421 GB:TO 1032669 GB:DIRECTION - GB:PRODUCT putative peptide carrier protein GB:NOTE nrps7 gene cluster, PF00550: Phosphopantetheine attachment site GB:PROTEIN_ID BAC68574.1 LENGTH 82 SQ:AASEQ MSDDEPTSTVDTTAVLLGIWQQLFRDQQVGLEDDFFDLGGHSLLATRVISQVRAALGKRVMFKDITECRTIALLSARIDEKR GT:EXON 1|1-82:0| BL:SWS:NREP 1 BL:SWS:REP 12->82|BACB_BACLI|5e-12|42.3|71/2607| PROS 37->52|PS00012|PHOSPHOPANTETHEINE|PDOC00012| BL:PDB:NREP 1 BL:PDB:REP 19->76|2vsqA|5e-09|41.4|58/1273| RP:PDB:NREP 1 RP:PDB:REP 16->82|3ci0K|2e-11|1.5|67/280| RP:PFM:NREP 1 RP:PFM:REP 14->78|PF00550|3e-06|35.4|65/67|PP-binding| HM:PFM:NREP 1 HM:PFM:REP 15->78|PF00550|9.6e-18|32.8|64/67|PP-binding| GO:PFM:NREP 1 GO:PFM GO:0048037|"GO:cofactor binding"|PF00550|IPR006163| RP:SCP:NREP 1 RP:SCP:REP 11->78|1dnyA|7e-15|29.4|68/76|a.28.1.2| HM:SCP:REP 5->80|1dnyA_|2.3e-12|32.9|76/76|a.28.1.2|1/1|ACP-like| OP:NHOMO 195 OP:NHOMOORG 96 OP:PATTERN -------------------------------------------------------------------- 1--------------3311-11--1-1111111---3143--1----------1------4---223114-------------------------------2---5---1-------------------1--------------3-12--442--------------319-----------------------------2-1----21---33----2-------------5--11111111111111------------------------------------------------------------------------------------------1------------------------------------------------1-2-----------------------------------2---------------1-----1----------1-------------------------------------------------------------1-1----------------------------------------------------------------------------A5--------------------------------------------------------------------------1----------------------------------------2-----------------------------------------------------21---------------------------3122125332-1122-533------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 98.8 SQ:SECSTR #cccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHTccccccccccccccGGGGGGcTTccHHHHHHHTTTEEcc PSIPRED ccccccccccHHHHHHHHHHHHHHccccccccccHHHHcccHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHcc //