[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68578.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  892/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1f.37.1
:600 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   346->595 2hydA PDBj 9e-29 35.4 %
:RPS:PDB   346->596 3b5jA PDBj 4e-40 31.8 %
:RPS:SCOP  346->597 1b0uA  c.37.1.12 * 3e-32 19.7 %
:HMM:SCOP  1->331 1pf4A2 f.37.1.1 * 8.5e-14 20.1 %
:HMM:SCOP  325->579 1pf4A1 c.37.1.12 * 7.2e-55 37.3 %
:RPS:PFM   387->518 PF00005 * ABC_tran 2e-14 42.1 %
:HMM:PFM   387->518 PF00005 * ABC_tran 1.4e-21 39.1 115/118  
:HMM:PFM   369->403 PF05783 * DLIC 0.00011 48.6 35/490  
:BLT:SWISS 348->581 SPAT_BACSU 4e-37 37.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68578.1 GT:GENE BAC68578.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1038659..1040461 GB:FROM 1038659 GB:TO 1040461 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE nrps7 gene cluster, PF00005: ABC transporter GB:PROTEIN_ID BAC68578.1 LENGTH 600 SQ:AASEQ MTRPGRPRCGPLRAALALSLEADRRATLITFVSFGLRPTVPVVILYLVRVVVDAIVSHDQTALWTAVGAATLATGLSMGSITYAIELNVRMIEATAAVVDRRLMRTIGGLPGVAHLDNPEVLDRVEMLRQERVHLSEGGDVFALVVGAVVRALVTGLVLAMVQPLLLFLPLLALPSLLASRRGQRKRSDAVARSATTSRLAGHLYTTGTSLPAGKEIRLFGLGPALRERYRTAAADADATVTRAVWGGLALNCAGGALFAVGYCGALFFVLHDFARGTTSLGDVVLVLGLVTSISTQLGQAVVFAGFLHQVLSASRRLLWLERYAADVARPAPTAPAPGPRLSTGIRFEGVHFQYPDTGTSVLRDIDLELPAGTVVAVVGANGAGKSTLIKLLTGLYEPTRGRITVDGVDLREAPLEAWYARTSGCFQDFSRLEFTVQHSVGAGSVPHADEAARVWEAVKRAAAADLVERLPNGLATELGASFDAGTELSGGQWQRIALARACMRRAPCLLVLDEPTAAIDPLAEDALLSAYVDAARQSAAAAGGITLFASHRLSTARGADLIVVVDSGRIVQLGRHGDLMAQRDSIYRDLYERQARAYA GT:EXON 1|1-600:0| BL:SWS:NREP 1 BL:SWS:REP 348->581|SPAT_BACSU|4e-37|37.0|227/614| TM:NTM 6 TM:REGION 31->53| TM:REGION 62->84| TM:REGION 134->156| TM:REGION 159->180| TM:REGION 248->270| TM:REGION 290->312| SEG 40->52|vpvvilylvrvvv| SEG 61->76|talwtavgaatlatgl| SEG 138->179|ggdvfalvvgavvralvtglvlamvqplllflpllalpslla| SEG 231->245|rtaaadadatvtrav| SEG 247->260|gglalncaggalfa| SEG 277->293|gttslgdvvlvlglvts| SEG 325->340|aadvarpaptapapgp| SEG 372->385|agtvvavvgangag| SEG 531->543|ayvdaarqsaaaa| BL:PDB:NREP 1 BL:PDB:REP 346->595|2hydA|9e-29|35.4|237/578| RP:PDB:NREP 1 RP:PDB:REP 346->596|3b5jA|4e-40|31.8|239/243| RP:PFM:NREP 1 RP:PFM:REP 387->518|PF00005|2e-14|42.1|114/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 387->518|PF00005|1.4e-21|39.1|115/118|ABC_tran| HM:PFM:REP 369->403|PF05783|0.00011|48.6|35/490|DLIC| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 346->597|1b0uA|3e-32|19.7|238/258|c.37.1.12| HM:SCP:REP 1->331|1pf4A2|8.5e-14|20.1|309/311|f.37.1.1|1/1|ABC transporter transmembrane region| HM:SCP:REP 325->579|1pf4A1|7.2e-55|37.3|244/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 13631 OP:NHOMOORG 1144 OP:PATTERN 331-22111443111271223241C446544431311------344392166416555322---4--- 94D4U8A7AAA98696777-7922CI767777BDDDJPLK2HBNFLHCCA88DGL47G33DGDCJCGVVb68999C98A6cL5112--7853-4359--53A654D5E7A111111111111113967AB97DA888BBCD433L2KCCH9A89C77C584D787AHQUTC4A775758466595955F93B6DGGIGIFJIAIHJFEJIIJJDGJJK67DFKJJEGHFFGNU97777776777777764435QDADNOD6E5FKJAAOMG85B9BEBDCEGHDBCGJIDHFEDBFGCFE7665687797757GHGCCCHGHEGCFGHIHIHJIG8IBFEJJ7CCCW9AHKOJE92abG5558656788F5657159AA966667A5PORA9CHJGHIGGGHHGIFFIV-IIKHGOHMPa94qUUfbfXjfgYaTF577HGWKJJJNKA88888888C9D8DB9H22222222233643674566554442241266613AKHELJJJOLMFCCDAJJIKGHFE9FJIJEBF823A96GA8EBMDOGNR7AC6C47A83444644866CD475C5BB8D7C8BBA2696787A496765EH3C534242222222233333333633487DE75F47478C9AAA97798886A8AA78A--54795221222JDIKCFECEEFCFGFBB-EBBBBBDBDDEEE99B99CEFLLMFHFB98BBBBBBCA9B9BAGB9B9A9B62LIIIJHFHGILI11433433379A853DEDA9A89B4A998477A3444443437HBGIHDLOJIGLNHL7NMP33323432338CAHEDFECJHFGI79A778677754442262663344--------k-D22224-4321632---326313112A68449A998274 2233FHB-KA44JKGA7HEHKLKOINKBB9BBBJJIAHEEEEEAA9GEIMKJSNDEJDBABAC98566265367A6624656543548-QW97IKG885C99AGHA3CeUsMVOdQaGE9DDMEUUAh9**W1cMgBEC8UCIjJCEGB9O98rDKFKRFW*BbKD9gHO*TVcO7C88*785DCXYZwEZgBEhTYXF ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 192-200, 327-339, 598-600| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEEcccccccEEccccEEEccccEEEEEccccccHHHHHHHHHHcccccccEEEEccEEcccccHHHHHHHccccccccEEEcccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEcccHHHccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHHHccc //