[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68583.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->23 PF03621 * MbtH 2e-06 65.2 %
:HMM:PFM   1->23 PF03621 * MbtH 2.1e-09 60.9 23/54  
:HMM:PFM   24->35 PF00832 * Ribosomal_L39 0.00033 50.0 12/43  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68583.1 GT:GENE BAC68583.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1044960..1045295) GB:FROM 1044960 GB:TO 1045295 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF03621: MbtH-like protein GB:PROTEIN_ID BAC68583.1 LENGTH 111 SQ:AASEQ MNDPFEDQDGSYVALMNDEGQYSARRRWRRSQINVRSSSSRPQVCTHRFMTEFILGIRTPLSTTSMPASSSTSSNNCGNFPSRSLIMQRARQPASTWSTTASHLDGRRRRR GT:EXON 1|1-111:0| SEG 59->74|tplsttsmpassstss| RP:PFM:NREP 1 RP:PFM:REP 1->23|PF03621|2e-06|65.2|23/53|MbtH| HM:PFM:NREP 2 HM:PFM:REP 1->23|PF03621|2.1e-09|60.9|23/54|MbtH| HM:PFM:REP 24->35|PF00832|0.00033|50.0|12/43|Ribosomal_L39| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 6-7, 29-40, 64-79, 105-111| PSIPRED cccccccccccEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHccc //