[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68595.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->101 1iujB PDBj 3e-13 43.2 %
:RPS:PDB   3->87 2bbeA PDBj 3e-13 12.9 %
:RPS:SCOP  3->102 1iujA  d.58.4.5 * 2e-13 36.1 %
:HMM:SCOP  1->106 1sqeA_ d.58.4.5 * 2e-23 36.2 %
:RPS:PFM   10->75 PF03992 * ABM 4e-04 37.9 %
:HMM:PFM   3->76 PF03992 * ABM 3.4e-20 29.7 74/78  
:BLT:SWISS 6->83 YHGC_BACSU 1e-10 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68595.1 GT:GENE BAC68595.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1059494..1059823 GB:FROM 1059494 GB:TO 1059823 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF03992: Antibiotic biosynthesis monooxygenase GB:PROTEIN_ID BAC68595.1 LENGTH 109 SQ:AASEQ MSVVKINVLTVPAEQRETLEKRFAARAHAVESSDGFEWFELLRPVEGTDDYLVYTRWRDEESFQAWMEGPMKAAHQGGNAESGERPKPAASGSTLWSFEVVQQAAPKSS GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 6->83|YHGC_BACSU|1e-10|39.0|77/166| BL:PDB:NREP 1 BL:PDB:REP 4->101|1iujB|3e-13|43.2|95/103| RP:PDB:NREP 1 RP:PDB:REP 3->87|2bbeA|3e-13|12.9|85/103| RP:PFM:NREP 1 RP:PFM:REP 10->75|PF03992|4e-04|37.9|66/78|ABM| HM:PFM:NREP 1 HM:PFM:REP 3->76|PF03992|3.4e-20|29.7|74/78|ABM| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF03992|IPR007138| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF03992|IPR007138| GO:PFM GO:0017000|"GO:antibiotic biosynthetic process"|PF03992|IPR007138| RP:SCP:NREP 1 RP:SCP:REP 3->102|1iujA|2e-13|36.1|97/102|d.58.4.5| HM:SCP:REP 1->106|1sqeA_|2e-23|36.2|105/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 56 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ------11222-1-11111-1-111111111-11111111-2121-111------11---11--1111-11-------------------------------------------------------------------------------------------------------------------11--------------------------1------1---------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 101 STR:RPRED 92.7 SQ:SECSTR ccEEEEEEEEEcTTcHHHHHHHHHTTHHHHHTcTTEEEEEEEEccccTTEEEEEEEEccHHHHHHHHTcHHHHHHHHTHHHHEEEEEEGccccEEEEEEcc######## DISOP:02AL 71-90, 107-109| PSIPRED ccEEEEEEEEcccccHHHHHHHHHHHHccHHHcccEEEEEEEccccccccEEEEEEEccHHHHHHHHcccHHHHHHHHHHccccccccccccccEEEEEEEEEcccccc //