[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68599.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:119 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  8->111 2evrA2  d.3.1.16 * 7e-11 21.0 %
:HMM:SCOP  10->119 2evrA2 d.3.1.16 * 4.6e-05 23.3 %
:HMM:PFM   32->80 PF00877 * NLPC_P60 0.00014 21.3 47/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68599.1 GT:GENE BAC68599.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1066921..1067280) GB:FROM 1066921 GB:TO 1067280 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00877: NlpC/P60 family GB:PROTEIN_ID BAC68599.1 LENGTH 119 SQ:AASEQ MADQPGLTAGGNCQLFAYEVLGLFGLTPPPLRSSELWGDTETTVRVSAPQPLDLLLFNASASAYGAHVGVWAGDDAVLHLCAEVGHPTVWGLADFAARERYRVLVGTKRVIGRSSNTLE GT:EXON 1|1-119:0| HM:PFM:NREP 1 HM:PFM:REP 32->80|PF00877|0.00014|21.3|47/105|NLPC_P60| RP:SCP:NREP 1 RP:SCP:REP 8->111|2evrA2|7e-11|21.0|100/148|d.3.1.16| HM:SCP:REP 10->119|2evrA2|4.6e-05|23.3|103/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------1---------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 115-119| PSIPRED cccccccEEcccHHHHHHHHHHHHcccccccccHHHHcccccEEEEEcccccEEEEEEccccccccEEEEEEcccEEEEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEcccccccc //