[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68602.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->78 PF04600 * DUF571 0.00011 19.0 63/425  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68602.1 GT:GENE BAC68602.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1070683..1071018) GB:FROM 1070683 GB:TO 1071018 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68602.1 LENGTH 111 SQ:AASEQ MALVVVEMAILALIGLSWMGSYWSWDPQHHGDPPGPYLKKAAVVPIAALVAMAVAGIRRMRAVAVSQAVMFIVICGTTLCLKAPGERVYEDSYRNACHAGMGCGDDSPTTR GT:EXON 1|1-111:0| TM:NTM 3 TM:REGION 1->19| TM:REGION 41->57| TM:REGION 63->85| HM:PFM:NREP 1 HM:PFM:REP 4->78|PF04600|0.00011|19.0|63/425|DUF571| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 105-111| PSIPRED cHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccc //