Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68604.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68604.1 GT:GENE BAC68604.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1072353..1072856) GB:FROM 1072353 GB:TO 1072856 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF08271: TFIIB zinc-binding GB:PROTEIN_ID BAC68604.1 LENGTH 167 SQ:AASEQ MPALHARPTSNAFNPAPAGETPVVGLGSGRHRRKARITGRLRLRMIAYRDVEFLSSRTPGDTGGGEEYLLLVHVRKVVGRVDYRICTACAEAVVTGVVIEERFHDTGLGARALAHLRFRHPGMAWRSALGLPTTRDFKRRMRLPTKGEDGLCSHVRRALPVPAPVAA GT:EXON 1|1-167:0| SEG 155->166|vrralpvpapva| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-37, 166-167| PSIPRED ccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHccHHHHHHHHHHHHHHEEEccccccccHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHccccccccccHHHHHHHccccccccc //