[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68609.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:PROS 159->173|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68609.1 GT:GENE BAC68609.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1077654..1078340) GB:FROM 1077654 GB:TO 1078340 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68609.1 LENGTH 228 SQ:AASEQ MTAGWCCRTVRAALFAAVCVLLAALGHVMMSGTAVPWWAMTVAALVTGGTGWCLAGRERGLALIVSVVVVAQGALHSAFSVAQSAAHSAGSVGADSMPKGSMGSDMSSVHMDSVHMDSMDMGNMGAGHLAHLGHDMGGGSSFGMLAAHSAAALLCGLWLAYGERAAFRILRALAGRLAAPLRLLLALPTPAHRPRIRVRRGSSDRTPRRLLLVHAITSRGPPVGTAVI GT:EXON 1|1-228:0| PROS 159->173|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 2 TM:REGION 19->41| TM:REGION 61->83| SEG 10->28|vraalfaavcvllaalghv| SEG 100->121|gsmgsdmssvhmdsvhmdsmdm| SEG 164->195|raafrilralagrlaaplrlllalptpahrpr| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 83-130, 194-207, 224-226| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHEEEcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEccccccccccc //