[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68610.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:132 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->122 2a4xA PDBj 2e-09 28.7 %
:RPS:PDB   1->125 2a4xA PDBj 1e-15 19.4 %
:RPS:SCOP  2->119 2i7rA1  d.32.1.2 * 3e-38 28.8 %
:HMM:SCOP  1->122 2i7rA1 d.32.1.2 * 3.7e-25 33.9 %
:RPS:PFM   73->116 PF00903 * Glyoxalase 2e-07 47.7 %
:HMM:PFM   6->118 PF00903 * Glyoxalase 2.5e-14 22.1 113/128  
:BLT:SWISS 1->119 YRAH_BACSU 1e-07 28.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68610.1 GT:GENE BAC68610.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1078669..1079067) GB:FROM 1078669 GB:TO 1079067 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF00903: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily GB:PROTEIN_ID BAC68610.1 LENGTH 132 SQ:AASEQ MNFVSIRVITDDVARLVEFYEQVTAVSATWSTPDFAEIVTPSCTLAVASSRTVALFGSGSARPASNRSLITEFRVADVDAEYQRLTPLGCEFVQTPTTMPWGNRSLLFRDPDGNLINFFTPVTPDAVRRQDR GT:EXON 1|1-132:0| BL:SWS:NREP 1 BL:SWS:REP 1->119|YRAH_BACSU|1e-07|28.6|119/128| BL:PDB:NREP 1 BL:PDB:REP 8->122|2a4xA|2e-09|28.7|115/131| RP:PDB:NREP 1 RP:PDB:REP 1->125|2a4xA|1e-15|19.4|124/131| RP:PFM:NREP 1 RP:PFM:REP 73->116|PF00903|2e-07|47.7|44/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 6->118|PF00903|2.5e-14|22.1|113/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 2->119|2i7rA1|3e-38|28.8|111/115|d.32.1.2| HM:SCP:REP 1->122|2i7rA1|3.7e-25|33.9|115/0|d.32.1.2|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 19 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----1----------11--------1-------------1---1------1---------------111---------------------1--------------1------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1-------1-----------------------------1------------------------------------------1-----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 132 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEcTTcEHHHHHHHcTTccccccccccEEEEEcEccHHHHHHHHHHHHHTTccEEEEEEEETTTEEEEEEEcTTccEEEEEEEcTTccccccEE DISOP:02AL 125-132| PSIPRED ccccEEEEEEccHHHHHHHHHHHcccEEEEccccEEEEEcccEEEEEccccccccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEccccHHHHcccc //