[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68612.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->117 3dxqB PDBj 4e-12 23.7 %
:RPS:SCOP  77->117 1nd4A  d.144.1.6 * 4e-06 24.4 %
:HMM:SCOP  1->137 1nd4A_ d.144.1.6 * 9.9e-19 33.8 %
:RPS:PFM   78->113 PF01636 * APH 1e-04 47.2 %
:HMM:PFM   1->64 PF01636 * APH 2.1e-05 26.6 64/238  
:HMM:PFM   74->136 PF01636 * APH 1.5e-16 38.1 63/238  
:BLT:SWISS 63->117 THIK_SALSV 3e-06 43.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68612.1 GT:GENE BAC68612.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1080407..1080958 GB:FROM 1080407 GB:TO 1080958 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01636: Phosphotransferase enzyme family GB:PROTEIN_ID BAC68612.1 LENGTH 183 SQ:AASEQ MAHLTACGYPVPKVYEVSDSDLVLERLTGPTMLEALAQRPWRVRGLGRMLGDLHDRLHGLPAPAWLPKRFGTGGDDRVLHLDLHPGNVILTGRGPVVIDWSNAGAGDPAADVAMTMVTVGSADVPGLAARLGRGLLLRAIQDGCATDPTPRVQEAVNAKLADPNLTTTEAAWLRNRAAVSAGP GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 63->117|THIK_SALSV|3e-06|43.6|55/274| SEG 126->139|glaarlgrglllra| RP:PDB:NREP 1 RP:PDB:REP 2->117|3dxqB|4e-12|23.7|114/280| RP:PFM:NREP 1 RP:PFM:REP 78->113|PF01636|1e-04|47.2|36/221|APH| HM:PFM:NREP 2 HM:PFM:REP 1->64|PF01636|2.1e-05|26.6|64/238|APH| HM:PFM:REP 74->136|PF01636|1.5e-16|38.1|63/238|APH| RP:SCP:NREP 1 RP:SCP:REP 77->117|1nd4A|4e-06|24.4|41/255|d.144.1.6| HM:SCP:REP 1->137|1nd4A_|9.9e-19|33.8|133/255|d.144.1.6|1/1|Protein kinase-like (PK-like)| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------1--1------------1--2--111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 63.4 SQ:SECSTR #HHHHHHTTccccEEEEcTTTcEEEccTTcEEcHHHHHcTTHHHHHHHHHHHHHTccccccccHHHTTccccccTTHEEcccccGGGEEEcccccEEcccTTcEEEcHHHHHHHHHH################################################################## DISOP:02AL 1-2, 42-46, 180-183| PSIPRED cccHHHcccccccEEcccccEEEEEEEEcHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEEcccccccEEEcccccEEEEEcccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccc //