[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68617.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:207 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68617.1 GT:GENE BAC68617.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1086726..1087349) GB:FROM 1086726 GB:TO 1087349 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68617.1 LENGTH 207 SQ:AASEQ MASPVAYAEAVASDTRRPVKEGQLTPHSLAFYMDVVASGTVLGAHPTDSPDRVTAMLGSDFAENSLDDHSMWRDYGMAEFFWIRETPDHPWEGHHFTLQVHRLSYSGGSIVNRAIRDRYGRFDRHLRFDKLERLLGKHGAPLEDAPDVNAPTFTRHWQPASQVSVMVFRAHEEWRQRRRGDDRIGDVYAIQSPARHRGPGRAAPAAP GT:EXON 1|1-207:0| SEG 175->186|rqrrrgddrigd| SEG 193->206|parhrgpgraapaa| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 195-207| PSIPRED ccccHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHcccEEEccccccHHHHHHHHHcHHHHccccHHHHHHHcccEEEEEEEccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccHHHHEEHHHHHHHHHHHHHccccccccEEEEcccHHHccccccccccc //