[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68618.1
DDBJ      :             putative dehydrogenase
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  79/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->271 3gpiA PDBj 2e-09 28.5 %
:RPS:PDB   4->309 2b69A PDBj 6e-15 14.4 %
:RPS:SCOP  4->309 2b69A1  c.2.1.2 * 4e-23 17.5 %
:HMM:SCOP  1->311 1qydA_ c.2.1.2 * 8.2e-38 31.0 %
:RPS:PFM   5->231 PF01370 * Epimerase 1e-16 34.3 %
:HMM:PFM   5->235 PF01370 * Epimerase 6.6e-18 25.3 221/238  
:BLT:SWISS 3->300 YFCH_ECOLI 6e-14 27.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68618.1 GT:GENE BAC68618.1 GT:PRODUCT putative dehydrogenase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1087677..1088615 GB:FROM 1087677 GB:TO 1088615 GB:DIRECTION + GB:PRODUCT putative dehydrogenase GB:NOTE PF01073: 3-beta hydroxysteroid dehydrogenase/isomerase family GB:PROTEIN_ID BAC68618.1 LENGTH 312 SQ:AASEQ MVMRVFVAGGTGVLGRRLVPQLVARGHQVTATTTSAAKLGLVERLGGEAVVMDGLDAVSVGEAVAAARPDVIVHQMTGISMAHAGKPDLKHFDRWSVPTVRLRTEGTDHLLAAAEATGVAHFVAQGYANWNGIREGGWVKTEEDALDLHEGTAAYTAMAALRHVEDAVLKADGAVMRYGAFYGPGATDDQLVLVRKRQFPLVGDGTGYASWVHLDDAASATVLAVEQKTRGVFNIVDDEPAPESEWLPWLAACAGAKPPMRVPRWLARLLAGDVVVTMMTEGRGFSNAKAKRELGWELRYPSWRQGFKEGLS GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 3->300|YFCH_ECOLI|6e-14|27.6|272/297| BL:PDB:NREP 1 BL:PDB:REP 10->271|3gpiA|2e-09|28.5|228/273| RP:PDB:NREP 1 RP:PDB:REP 4->309|2b69A|6e-15|14.4|278/302| RP:PFM:NREP 1 RP:PFM:REP 5->231|PF01370|1e-16|34.3|216/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 5->235|PF01370|6.6e-18|25.3|221/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 4->309|2b69A1|4e-23|17.5|285/312|c.2.1.2| HM:SCP:REP 1->311|1qydA_|8.2e-38|31.0|274/312|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 93 OP:NHOMOORG 88 OP:PATTERN -------1---------1---------1-11-------------------------------1----- ----2--------------------1------2-------2-21-1--------------------11--------------------------------------------------------------------1-----------1-11-------------1-111-----------------------------1------1-------------------------1-111111111111111--11---------------------------------------------------------------------------------------------------------------------------1111-----1-11-----------------------------111-------1---11-1-1-----1--------------11--11--1----------------------------11-1------------1------21--------1------------------1---------------------------------111--1----------1-------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-------------------1----------------11--------------------------------------------------------------------------------------1--------1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--11--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 99.7 SQ:SECSTR HcEEEEEETTTcHHHHHHHHHHTTcEEEEEEccccccccTEEccccccGGGTGGGTTcTTEEEEEccTTccccccccEEEEccccccTcccHHHHTcHHHHHHHHHHHHHHHHHHHHHTcEEEEEEEGGGGccccccTTcccccccccTTHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEcTTcTcccHHHHHTccEEEEcccccEEEcEEHHHHHHHHHHHTcccccccEEEccccEEEHHHHHHHHHHHHTccccEEEEccGcEEEEEEEcccTTcccccccccHHHHHHccccccccHHHHHHHHH# DISOP:02AL 312-313| PSIPRED cccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccHHHHHHHccccEEEEccccHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHccccEEcccccEEccEEHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHcccccccccHHHHHHHccHHHHHHccccccccHHHHHHHcccccccccHHHHHHHHHc //