[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68624.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   76->165 3cisG PDBj 2e-04 33.7 %
:RPS:PDB   5->165 3cisE PDBj 3e-13 23.4 %
:RPS:SCOP  83->164 1mjhA  c.26.2.4 * 1e-13 20.0 %
:HMM:SCOP  22->176 2gm3A1 c.26.2.4 * 4e-24 35.9 %
:RPS:PFM   102->162 PF00582 * Usp 3e-06 44.3 %
:HMM:PFM   23->163 PF00582 * Usp 2.2e-23 29.2 137/140  
:BLT:SWISS 102->162 USPAL_ARATH 2e-05 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68624.1 GT:GENE BAC68624.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1093703..1094287 GB:FROM 1093703 GB:TO 1094287 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF00582: Universal stress protein family GB:PROTEIN_ID BAC68624.1 LENGTH 194 SQ:AASEQ MGLGYPCGCAPRGDRAMGDVEGRRIVAGVSGSLGSLAALHRAAHEARRSRAELLAVLAWEPPGGDLAHRRSLLASPATDFRQEAGERLLAALRTAFGDAGPGVPFQGLVARGTPGRALVETADRADDLLVVGAGYRGRMHRALFPSVARYCVAHAACPVLAVPPSPLQGELASVHRRISLRLPLDARELTDGRP GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 102->162|USPAL_ARATH|2e-05|32.8|61/175| SEG 35->55|slaalhraahearrsraella| BL:PDB:NREP 1 BL:PDB:REP 76->165|3cisG|2e-04|33.7|86/292| RP:PDB:NREP 1 RP:PDB:REP 5->165|3cisE|3e-13|23.4|154/291| RP:PFM:NREP 1 RP:PFM:REP 102->162|PF00582|3e-06|44.3|61/139|Usp| HM:PFM:NREP 1 HM:PFM:REP 23->163|PF00582|2.2e-23|29.2|137/140|Usp| GO:PFM:NREP 1 GO:PFM GO:0006950|"GO:response to stress"|PF00582|IPR006016| RP:SCP:NREP 1 RP:SCP:REP 83->164|1mjhA|1e-13|20.0|80/143|c.26.2.4| HM:SCP:REP 22->176|2gm3A1|4e-24|35.9|153/0|c.26.2.4|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 162 STR:RPRED 83.5 SQ:SECSTR ####ccEEEEcTTcccccccccccEEEEccccHHHHHHHHHHHHHHHHTTccEEEEEEccccccHHHcccTTcccccHHHHHHHHHHHHHHHHTTHHHHcTTccEEEEEEcccHHHHHHHHGGGcccEEEEEcccccccTTccccHHHHHHHHHccccEEEEcccc############################ DISOP:02AL 16-18, 168-171, 189-194| PSIPRED cccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHccccEEEEEcccccHHHHEEEcHHHHHHHHHccccEEEEEcccccccHHHHHHHHHEEcccHHHccccccc //