[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68625.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68625.1 GT:GENE BAC68625.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1094554..1094970 GB:FROM 1094554 GB:TO 1094970 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68625.1 LENGTH 138 SQ:AASEQ MSPVEYSEDPEPSERFPAGLLHVPVRSGPAGCTARFFRTPLGGRTAVGFTSAAKLTATLGTDQACIRLSEPALRALAAPLGVTALTVDPPFSAPAADRTAATIREHENSWRRLHPRRVGALRVTGAAAVVACLNLLIG GT:EXON 1|1-138:0| TM:NTM 1 TM:REGION 118->138| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccccccHHHccccEEEEEccccccccHHHHHHccccccEEEccccccEEEEEccccHHEEEEccHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHHHcc //