[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68631.1
DDBJ      :             putative anti-sigma factor antagonist
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.13.2
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->102 1thnB PDBj 4e-07 31.0 %
:RPS:PDB   7->106 1auzA PDBj 2e-13 26.0 %
:RPS:SCOP  4->106 1vc1A  c.13.2.1 * 9e-16 23.3 %
:HMM:SCOP  7->116 1h4xA_ c.13.2.1 * 1.1e-23 35.5 %
:HMM:PFM   18->111 PF01740 * STAS 1.2e-14 22.3 94/117  
:BLT:SWISS 19->106 SP2AA_PAEPO 2e-07 30.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68631.1 GT:GENE BAC68631.1 GT:PRODUCT putative anti-sigma factor antagonist GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(1102907..1103326) GB:FROM 1102907 GB:TO 1103326 GB:DIRECTION - GB:PRODUCT putative anti-sigma factor antagonist GB:NOTE PF01740: STAS domain GB:PROTEIN_ID BAC68631.1 LENGTH 139 SQ:AASEQ MTDMSPLTITTRDAPTGPVLEITGDLDHETSPELRHAIDRLTLARGQLLVLDLAGLRFCDSSGITLLLAARNLAIEAGVDTVLAAVPANTARVLGIVGLDQVFAFYPDTRAATAAHPPTAVIADTTPRGTGSRADQVES GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 19->106|SP2AA_PAEPO|2e-07|30.7|88/117| SEG 107->123|pdtraataahpptavia| BL:PDB:NREP 1 BL:PDB:REP 19->102|1thnB|4e-07|31.0|84/114| RP:PDB:NREP 1 RP:PDB:REP 7->106|1auzA|2e-13|26.0|100/116| HM:PFM:NREP 1 HM:PFM:REP 18->111|PF01740|1.2e-14|22.3|94/117|STAS| RP:SCP:NREP 1 RP:SCP:REP 4->106|1vc1A|9e-16|23.3|103/110|c.13.2.1| HM:SCP:REP 7->116|1h4xA_|1.1e-23|35.5|110/111|c.13.2.1|1/1|Anti-sigma factor antagonist SpoIIaa| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------------------------------1--2111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 71.9 SQ:SECSTR ######ccccEEEETTEEEEcccccccTTHHHHHHHHHHHHHcccccEEEEEccccccccTTHHHHHHHHHHHHHHHTccccEEcccTTTTHHHHHHccGGGTccc################################# DISOP:02AL 1-7, 115-139| PSIPRED cccccccEEEEEEcccEEEEEEEcEEEEccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEccccHHHHHHccccccccccccccccccccccccc //