[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68635.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 103->171 TRYT_PIG 8e-04 28.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68635.1 GT:GENE BAC68635.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1108453..1109142 GB:FROM 1108453 GB:TO 1109142 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68635.1 LENGTH 229 SQ:AASEQ MALPRSPAAALPGPQWAEQDSWSYRDLDQAPLSAECRDELETLRAEAGGGRPPGGWPAGWPAPPLVVRESLFLCLFRAALARGELRYGRFVWQDLDSELGVHYQESRAALLNGIVLIGLRTFCDQISGGEAAQMELVVPMAVGTPNEPAGLVVAAETTARGPELLVDVWGETAVAACWQALIAVCRYVASLAGEDQYCRPLVPGGVHAADGFLTVVPQAMHAVDRQGPR GT:EXON 1|1-229:0| BL:SWS:NREP 1 BL:SWS:REP 103->171|TRYT_PIG|8e-04|28.4|67/100| SEG 44->64|raeagggrppggwpagwpapp| SEG 71->82|lflclfraalar| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 45-50, 224-229| PSIPRED cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccEEHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEcccccccccEEEEEcccccccHHEEHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHccHHHHHHHHHHHHHccccc //