[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68638.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
:287 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68638.1 GT:GENE BAC68638.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1120720..1121583 GB:FROM 1120720 GB:TO 1121583 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68638.1 LENGTH 287 SQ:AASEQ MSTRYRSEAAVEQVLTAAAGKVSAGEPPPDDVLDWLARLRLLEGVPFAYLVTDERLLPLESARFFFLDRNWTDAAVDGALSAGPSTTRDRAHLVARHGRIRDAVDASERNVWIKAARPGLSYDAEPVGTVTGFLLRSRAVSGWPGLRAQAFHEGQPVRPLRIERLAPAVLLALFDGLPTRVLVEEPHQGLQFGVDLADGGVFTVARRPPEPEGAATVLFRPSGCGVVDVRRLWADLGHTTAADGAATFALHLVQRPYQQEFSGTGEGPLFSPSISLDDLAAAFEESP GT:EXON 1|1-287:0| OP:NHOMO 21 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1----------------------------------------------------------------------------2-------1-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------1----------------------1-1111-----221121---1--------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 285-287| PSIPRED ccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccEEEccccccccHHHcEEEEEcHHHHHHHHHccEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccEEEEEEEHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccEEEEEEEccccEEEEEcccccccccEEEEEccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHcccccccEEcccccHHHHHHHHcccc //