[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68643.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  905/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:341 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   37->273 2yyzA PDBj 1e-25 30.8 %
:RPS:PDB   37->237 2dwoA PDBj 5e-39 5.3 %
:RPS:SCOP  36->252 1b0uA  c.37.1.12 * 3e-39 27.6 %
:HMM:SCOP  36->266 1g6hA_ c.37.1.12 * 3.9e-54 33.3 %
:RPS:PFM   76->191 PF00005 * ABC_tran 7e-10 31.3 %
:HMM:PFM   76->191 PF00005 * ABC_tran 7.6e-18 33.6 113/118  
:HMM:PFM   45->94 PF03193 * DUF258 0.00021 24.5 49/161  
:BLT:SWISS 36->243 BCRA_BACLI 8e-43 43.8 %
:PROS 163->177|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68643.1 GT:GENE BAC68643.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1129772..1130797 GB:FROM 1129772 GB:TO 1130797 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC68643.1 LENGTH 341 SQ:AASEQ MRGRGWRSFSNRGWRRGSQPRAGRGGSLSSRTITGMIEVTDLTKRYGTTTVVEGLTFQVRTGRVTGFLGPNGAGKSTAMRMMLGLDRPTAGEVRIDGAPYQRLRDPLRTVGALLDARAVHPGRTALNHLRWLARSNRIPPRRVREVIELAGLRSAVRRRAGTFSLGMSQRLGIAAALLGDPAVLVLDEPVNGLDPEGVLWLRHLMRDLAAQGRTVFVSSHLMSEAALTVDHLVIIGRGRLLADTSMSEFIDRYTDVGVRVRTPEPRRLRDVLVGAGITVTDCSDGSLKVAAAAERIGELVAAHAVTVHEVTRKTVSLEEAFMRLTAAAVEYRAESPGGVRR GT:EXON 1|1-341:0| BL:SWS:NREP 1 BL:SWS:REP 36->243|BCRA_BACLI|8e-43|43.8|208/306| PROS 163->177|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 300->311|vaahavtvhevt| BL:PDB:NREP 1 BL:PDB:REP 37->273|2yyzA|1e-25|30.8|234/358| RP:PDB:NREP 1 RP:PDB:REP 37->237|2dwoA|5e-39|5.3|190/449| RP:PFM:NREP 1 RP:PFM:REP 76->191|PF00005|7e-10|31.3|115/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 76->191|PF00005|7.6e-18|33.6|113/118|ABC_tran| HM:PFM:REP 45->94|PF03193|0.00021|24.5|49/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 36->252|1b0uA|3e-39|27.6|217/258|c.37.1.12| HM:SCP:REP 36->266|1g6hA_|3.9e-54|33.3|231/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 39548 OP:NHOMOORG 1166 OP:PATTERN TTH8KGDGJJKJIHMIhDNMGMNVkJNXXSZOC8A998FDFC6SaIXVJKwnV7KYHQTIHEHCR168 PWqK*bXbiijVYTUUTNN-Ni99Y*OOOOOOoqosw***V*Y*q*rmkigKvqpOPYCDtt*g*v****dTOOOrSSSMwWcA4858RQPL3LBEC--EEKEHJUIWQP44445447787777DMJDKQEHOJOKinnryGFG*cbWgnVUdadPQMHLGJEXaVesrrR8L9C767LBBB8dabOMZT8Vco********u*******wyypr***Yhn*vchlnokkf**SVVVWVUTVWVVVUWPSOMQiTQSrsQKNOSjjNNtwUOKNUWWVWbcdeaVdgcfcecbacdgcfaVUVUTVVVXVVUSmbYTRTbZcZYplqyqpqtursWqTgpppTVXU*abaP*YZNH**cVWVZWMZZSaWJIMYHbVRRKGIFIJZS***WQm****************-ik*fb*l***NA**************HHI**********ONOOOOOOtYcKQgVz78514333432645775435344465362GCDBBA***r*******ywuup*****w**i*******z9Jqpmyfpgh*u****PccHPHKYSHHHHHIHNNMVihYt*RRReeSdlXWfEaYXOSThRTcZZcqwUx9GEG7999B78655665655AK7ABKJkgnMhPSITCfOPRSPHPUPPPMPQVQPSW5-7IRLO---111zi**Qukglllhnkoef-jfggmjmhhglnggffffg*****YeVaYXabaaabaaaaZaY*aXYffecN2uvwy*yyww***32FHCECDCIHIJMFyl*PQPUOPEKMIHKGJTFHJIHDMAFLlVonqmu***vy*wwj***C99799989GSWWjdeeeeiojjiOORLLLMMNOHFHF23MLHHCCDF35454454fBF66554-684495377742B553444NZUHMZiYdYBbN --22TWC-PD5BIOD99C55FJDI9JDDD5877FCC7D89AAA97996AGEDIHCBF57768533-3322-13531212312333513-BA499635443524DJ71JKJVPUOXPTFED8HSHmk8qE**i4jPdJHG8aCGeSAJCEFVDB*FUPJmFV*DZJb5jSU*eWL9DFF5*A79EKuUR*5yn97*s**G ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-33, 325-341| PSIPRED cccccccccccccccccccccccccccccccccccEEEEEEEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHcccEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHEEEEccEEEEEccHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEccccEEEEEccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHccccccccccc //