[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68644.1
DDBJ      :             putative ABC transporter permease protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:257 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68644.1 GT:GENE BAC68644.1 GT:PRODUCT putative ABC transporter permease protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1130794..1131567 GB:FROM 1130794 GB:TO 1131567 GB:DIRECTION + GB:PRODUCT putative ABC transporter permease protein GB:NOTE PF01061: ABC-2 type transporter GB:PROTEIN_ID BAC68644.1 LENGTH 257 SQ:AASEQ MTSNSPRAVLAAEWIKVWTVRSTSFTLLLAFVLSTGLGTVVAFSWRGHIERVVNFSPLFAGLYGVTLGQLALVVFGVLLVGSEYSSGSIRTSLSAVPRRGLLYGGKVLAGTLAALAGSTVTVIVTFAGAQAALGPYGITLTAHGVPAAVVGAIVYLTLICTLSMGIAAIVRSSAISLGVLLPLLFLGSQGLGNVPALKPVLQYLPDQAGLELMRIAGPPGDGRFGPDYGPSTALVILLAWTAAALTGGYLVLRRRDA GT:EXON 1|1-257:0| TM:NTM 6 TM:REGION 23->45| TM:REGION 57->79| TM:REGION 105->127| TM:REGION 138->160| TM:REGION 168->190| TM:REGION 230->250| SEG 67->81|lgqlalvvfgvllvg| SEG 104->122|ggkvlagtlaalagstvtv| SEG 177->192|lgvllpllflgsqglg| SEG 232->246|talvillawtaaalt| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------211----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 256-257| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHccEEEEEEEccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //