[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68667.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->56 PF05532 * CsbD 2.5e-08 36.5 52/53  
:BLT:SWISS 2->56 Y782_AGRT5 3e-05 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68667.1 GT:GENE BAC68667.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1218275..1218448 GB:FROM 1218275 GB:TO 1218448 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF05532: CsbD-like GB:PROTEIN_ID BAC68667.1 LENGTH 57 SQ:AASEQ MSAGEKAKAKAEQVVGKAVRKAAHAMGQETTAAKGAALEARGKARDTKERAKGSFRH GT:EXON 1|1-57:0| BL:SWS:NREP 1 BL:SWS:REP 2->56|Y782_AGRT5|3e-05|32.7|55/63| HM:PFM:NREP 1 HM:PFM:REP 5->56|PF05532|2.5e-08|36.5|52/53|CsbD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 38-57| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccccccHHHHHcccccc //