[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68668.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:HMM:PFM   4->43 PF00324 * AA_permease 0.00051 28.2 39/479  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68668.1 GT:GENE BAC68668.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1218971..1219141 GB:FROM 1218971 GB:TO 1219141 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC68668.1 LENGTH 56 SQ:AASEQ MVPLLLVLLLALILFGAGFALKALWWIAVIVLVIWLVGFFARSSGAGGKRGRWYRW GT:EXON 1|1-56:0| TM:NTM 1 TM:REGION 13->35| SEG 4->37|lllvlllalilfgagfalkalwwiavivlviwlv| SEG 41->52|arssgaggkrgr| HM:PFM:NREP 1 HM:PFM:REP 4->43|PF00324|0.00051|28.2|39/479|AA_permease| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //