[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC68670.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:135 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->120 1s7iA PDBj 8e-10 36.1 %
:RPS:SCOP  26->126 1mwqA  d.58.4.7 * 3e-06 14.6 %
:HMM:SCOP  1->126 1s7iA_ d.58.4.9 * 1.2e-24 35.3 %
:RPS:PFM   73->103 PF03795 * YCII 2e-06 58.1 %
:HMM:PFM   17->107 PF03795 * YCII 2.1e-13 30.3 66/95  
:BLT:SWISS 69->131 Y369_RHIME 7e-06 41.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC68670.1 GT:GENE BAC68670.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 1219827..1220234 GB:FROM 1219827 GB:TO 1220234 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF04946: DGPF domain GB:PROTEIN_ID BAC68670.1 LENGTH 135 SQ:AASEQ MAKYLLLKHYRGAPAAVNDVPMDQWTPEEISAHIQYMNDFAARLEGTGEFVDGQALAPEGTFVRYDGEGRPPVTDGPFAETKDLIAGWMVIDVDSYERAVELAGELSAAPGAGGKPIHEWLELRPFLAAPPTITE GT:EXON 1|1-135:0| BL:SWS:NREP 1 BL:SWS:REP 69->131|Y369_RHIME|7e-06|41.4|58/100| BL:PDB:NREP 1 BL:PDB:REP 3->120|1s7iA|8e-10|36.1|108/124| RP:PFM:NREP 1 RP:PFM:REP 73->103|PF03795|2e-06|58.1|31/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 17->107|PF03795|2.1e-13|30.3|66/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 26->126|1mwqA|3e-06|14.6|82/100|d.58.4.7| HM:SCP:REP 1->126|1s7iA_|1.2e-24|35.3|116/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 41 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- --2-2--------------------1------11112142-112-2--------------111-321112---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 80.0 SQ:SECSTR ##EEEEEEEEcGGGccc##ccH#####HHHHHHHHHHHHHHHHHHHHTcEEEEEEcGGGcEEEEEcc#ccEEEEEccccccccEEEEEEEEEEccHHHHHHHHTTc##GGGGGcEEcccc############### DISOP:02AL 131-135| PSIPRED cccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEcccccccccEEEEEEccccEEEEEccccccHHccccEEEEEcccHHHHHHHHHHcccccccccEEEEEEEEEEccccccccccc //